PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 385aa    MW: 44100 Da    PI: 6.8934
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17203.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093123472055
                 HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  KHN17203.1 312 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 347
                 5679*****************************885 PP

2ELK35.91.6e-12267288122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++Ll+KYsgyL+sLkqE+s
  KHN17203.1 267 ELKNHLLKKYSGYLSSLKQELS 288
                 9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.9E-19124168IPR005540KNOX1
PfamPF037904.1E-21125167IPR005540KNOX1
SMARTSM012564.3E-30175226IPR005541KNOX2
PfamPF037911.3E-24179225IPR005541KNOX2
PfamPF037897.6E-10267288IPR005539ELK domain
PROSITE profilePS5121311.243267287IPR005539ELK domain
SMARTSM011881.0E-6267288IPR005539ELK domain
PROSITE profilePS5007112.989287350IPR001356Homeobox domain
SuperFamilySSF466891.33E-19288363IPR009057Homeodomain-like
SMARTSM003892.1E-13289354IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-27292353IPR009057Homeodomain-like
CDDcd000862.01E-12299351No hitNo description
PfamPF059201.1E-16307346IPR008422Homeobox KN domain
PROSITE patternPS000270325348IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEEYTSNNHL SENTGPSPST PRPNFLYSSA SGGNHNHQHQ HHSHHHHHHH QFPINTFHLQ  60
SGGSDHCFQS DQVSPHPSVK SEASTSQLHA PIFHYPLMRG NLHNTMHHPQ QQGGSPTSST  120
GEVEAIKAKI IAHPQYSNVL EAYMDCQKIG APPEVVARMA AAKQEFEARQ RSSVGSRETS  180
KDPELDQFME AYYDMLVKYR EELTRPIQEA MDFMRRIETQ LNMLCNGPVR IFSDDKCEGA  240
GSSEEDQDNS GGETELPEID PRAEDRELKN HLLKKYSGYL SSLKQELSKK KKKGKLPKDA  300
RQKLLNWWEL HYKWPYPSES EKVALAESTG LDQKQINNWF INQRKRHWKP SEDMQFMVMD  360
GLHPQSATLY MDGHYMADGH YRLGP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1070020.0HM107002.1 Glycine max KNOX-like DNA-binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001253999.10.0homeobox protein knotted-1-like 2-like
SwissprotO041351e-178KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A0B2QAY90.0A0A0B2QAY9_GLYSO; Homeobox protein knotted-1-like 2
TrEMBLI1M8Y10.0I1M8Y1_SOYBN; KNOX-like DNA-binding protein
STRINGGLYMA14G10430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45843246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-144KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]